PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G219100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 224aa    MW: 25759.6 Da    PI: 6.873
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G219100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.18.5e-08752346
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                        +W+  Ed+++ +a  +++ +   +W++I+++++ g++  +++ ++ +
  Potri.001G219100.1  7 SWSRLEDKQFEQALVLFPEEtprRWEKISSYVP-GKSWREVRKHYED 52
                        6*****************99*************.***********76 PP

2Myb_DNA-binding43.95.7e-14106150347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ l++ + +++G+g+W++I+r     Rt+ q+ s+ qky
  Potri.001G219100.1 106 PWTEEEHRLFLIGLQKYGKGDWRSISRNAVVSRTPTQVASHAQKY 150
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.497158IPR017930Myb domain
SMARTSM007172.6E-9456IPR001005SANT/Myb domain
PfamPF002497.5E-7753IPR001005SANT/Myb domain
SuperFamilySSF466893.8E-11762IPR009057Homeodomain-like
CDDcd001676.98E-7754No hitNo description
PROSITE profilePS5129419.44599155IPR017930Myb domain
SuperFamilySSF466894.97E-17100156IPR009057Homeodomain-like
SMARTSM007171.2E-10103153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-12103149IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-17103153IPR006447Myb domain, plants
PfamPF002491.4E-11106150IPR001005SANT/Myb domain
CDDcd001674.78E-9106151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MSSHLSSWSR LEDKQFEQAL VLFPEETPRR WEKISSYVPG KSWREVRKHY EDLVHDVLEI  60
DSGRVEVPLY DQDELWGDST TSLGGAAAES RSGKEREHTE RRKGTPWTEE EHRLFLIGLQ  120
KYGKGDWRSI SRNAVVSRTP TQVASHAQKY FLRLNSVKKE KKRSSIHDIT ATNATHSMAQ  180
TSHDPNWNFE LMDQSVDEPL SRPANFFHDQ GNPLAYQGFG FPM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A9e-138701173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006061.11e-154PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9GI071e-140B9GI07_POPTR; Uncharacterized protein
STRINGPOPTR_0001s22660.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.19e-73MYB family protein